PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco005341.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family WRKY
Protein Properties Length: 272aa    MW: 29455.6 Da    PI: 4.9323
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco005341.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY57.13.6e-181511882259
                  EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY  22 rsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                   sYYrCt+++C vkk+vers++dp++v++tYeg+Hnh+
  Aco005341.1 151 VSYYRCTTQKCGVKKRVERSHQDPSIVITTYEGQHNHQ 188
                  59***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007742.7E-10143189IPR003657WRKY domain
PfamPF031061.3E-13147188IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.8E-16149190IPR003657WRKY domain
SuperFamilySSF1182902.88E-14151190IPR003657WRKY domain
PROSITE profilePS5081117.718152190IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MPLLHHEDPS SSLLFSNMPG ATHRHDLSGA VDVAPYVMSF ADYLHGAVDY AALARGFDAL  60
PDHGMLIGGC IDNSNSGAEK LTAPDAAGGG GATPMTANSS VSSSSSEAAV GDEESDLCRK  120
EKVKEEEEEE EEEEKEKIKE GEEGSEKSKK VSYYRCTTQK CGVKKRVERS HQDPSIVITT  180
YEGQHNHQSP ATFRGGMHHF VAPHAAPSCF MSQDFLVQQV ANSMINNNGH QMGINPSLYL  240
PSLQPTLQQH QFPDYGLLED IVPSFIHSNQ P*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008798309.14e-61PREDICTED: probable WRKY transcription factor 28
TrEMBLM0SP142e-60M0SP14_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P14990_0015e-60(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62337173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.12e-24WRKY DNA-binding protein 71